Products

BMP-14 (Bone morphogenetic protein-14), Human

Bone morphogenetic proteins (BMPs) are a group of growth factors also known as cytokines and as metabologens. BMP-14 is a principal inhibitor of cartilage development and is predominantly expressed in long bone during human embryonic development. Recombinant human BMP-14 is a 27 kDa homodimeric protein consisting of two 120 amino acid polypeptide chains.
No. Size Price Qty Status
C01075-5UG 5 ug $96.00 Inquiry
C01075-20UG 20 ug $240.00 Inquiry
C01075-100UG 100 ug $475.20 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
MAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRL
SPISILFIDSANNVVYKQYEDMVVESCGCR with polyhistidine tag at the C-terminus

UnitProt ID:
P43026
 
Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <14 ng/mL.
 
Purity:
>98% as determined by SDS-PAGE. 

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate and 0.2 M NaCl, pH 3.5.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in 4 mM HCl to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <14 ng/mL.
Reviews for BMP-14 (Bone morphogenetic protein-14), Human

Average Rating: 0 (0 Reviews )